• PENGUMUMAN HASIL SELEKSI ADMINISTRASI

    PENGADAAN CALON PEGAWAI APARATUR SIPIL NEGARA (CPASN) FORMASI UMUM DILINGKUNGAN PEMERINTAH KABUPATEN MAMASA TAHUN 2021

    Berdasarkan hasil verifikasi seleksi Administrasi dalam Penerimaan Calon Pegawai Aparatur Sipil Negara di Lingkungan Pemerintah Kabupaten Mamasa Formasi Umum Tahun 2021 secara online melalui portal https://sscasn.bkn.go.id/ dengan ini menetapkan hal-hal sebagai berikut:

     

    1.  Bahwa tahapan seleksi administrasi pelamar dalam penerimaan Calon Aparatur Sipil Negara Formasi Umum Tahun 2021 telah selesai dilaksanakan;

    2.  Bagi pelamar seleksi penerimaan Calon Pegawai Aparatur Sipil Negara Pemerintah Kabupaten Mamasa yang nomor register dan namanya tercantum dalam Lampiran Pengumuman I (satu) dinyatakan Memenuhi Syarat (MS) Lulus Seleksi Administrasi;

    3.  Bagi pelamar seleksi penerimaan Calon Pegawai Aparatur Sipil Negara Pemerintah Kabupaten Mamasa yang Nomor Register dan NIK tercantum dalam Lampiran Pengumuman II (dua) dinyatakan Tidak Memenuhi Syarat (TMS) Seleksi Administrasi dan keterangan lebih lanjut dapat dilihat melalui akun masing-masing pada portal https://sscasn.bkn.go.id;

    4.  Pelamar yang dinyatakan lulus Seleksi Administrasi berhak mengikuti seleksi tahapan selanjutnya yaitu Seleksi Kompetensi Dasar (SKD) dengan menggunakan sistem Computer Assisted Test (CAT) yang pelaksanaannya akan menyesuaikan dengan kebijakan Pemerintah terkait dengan Pandemi Covid-19;

    5.  Pelamar yang Keberatan terhadap pengumuman seleksi administrasi, dapat mengajukan sanggahan paling lama 3 (tiga) hari kalender sejak hasil seleksi administrasi diumumkan dengan cara login ke https://daftar-sscasn.bkn.go.id/login kemudian mengisi sanggahan dengan menjabarkan kronologis dan mengunggah bukti dukung yang diperlukan;

    6.  Panitia seleksi instansi dapat menerima alasan sanggahan sebagaimana dimaksud pada angka 5 (lima) dalam hal kesalahan bukan berasal dari pelamar;

    7.  Dalam hal alasan sanggahan sebagaimana dimaksud pada angka 5 (lima) diterima, panitia seleksi instansi mengumumkan ulang hasil seleksi administrasi paling lama 7 (tujuh) hari sejak berakhirnya waktu pengajuan sanggahan;

     

    8.  Bagi Pelamar Tenaga Kesehatan yang STR-nya telah habis masa berlaku dan saat ini dalam proses masa perpanjangan dan dinyatakan Tidak Memenuhi Syarat (TMS) Administrasi dalam pengumuman ini berdasarkan Surat Edaran Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Republik Indonesia Nomor B/1121/S.SM.01.00/2021 dapat menyampaikan sanggahan kepada Panitia Seleksi Instansi dengan cara login ke https://daftar-sscasn.bkn.go.id/login, melampirkan bukti sudah melakukan minimal tahap pembayaran pada proses perpanjangan STR dalam bentuk tangkap layar pada laman Komite Farmasi Nasional (KFN), Konsil Kedokteran Indonesia (KKI) atau Majelis Tenaga Kesehatan Indonesia (MTKI).

    9.    Pengumuman Hasil Seleksi Administrasi CPASN Formasi PPPK Guru di Lingkungan Pemerintah Kabupaten Mamasa Provinsi Sulawesi Barat Tahun 2021 akan disampaikan oleh Pihak Kementerian Pendidikan, Kebudayaan Riset dan Teknologi Republik Indonesia yang terpisah dari pengumuman ini;

    10. Pengumuman atau Informasi lebih lanjut terkait jadwal dan ketentuan Seleksi Kompetensi Dasar (SKD) dengan Computer Assisted Test (CAT) akan diumumkan kemudian melalui Portal https://sscasn.bkn.go.id/ dan website Pemerintah Kabupaten Mamasa : https://mamasakab.go.id dan/atau website Badan Kepegawaian Pendidikan dan Pelatihan (BKPP)  Kabupaten Mamasa https://bkpp.mamasakab.go.id/ .



    (DOWNLOAD DISINI)

    Download Lampiran : pengumumanadmin.pdf

    Download Lampiran : pengumumanadmin.pdf

  • Pengumuman Hasil Verifikasi Sanggahan

    PENGUMUMAN HASIL VERIFIKASI SANGGAHAN PENGADAAN CALON APARATUR SIPIL NEGARA DILINGKUNGAN PEMERINTAH KABUPATEN MAMASA TAHUN 2021


    Berdasarkan Pengumuman Ketua Panitia Seleksi Daerah Penerimaan Calon Pegawai Aparatur Sipil Negara di Lingkungan Pemerintah Kabupaten Mamasa Formasi Umum Tahun 2021 Nomor 800 /132/ VIII / BKPP / 2021 tentang hasil Seleksi Administrasi Pengadaan Calon Pegawai Aparatur Sipil Negara di Lingkungan Pemerintah Kabupaten Mamasa Formasi Umum Tahun 2021 dengan ini menetapkan hal-hal sebagai berikut:

     

    1.  Pelamar TMS telah melakukan sanggahan terhadap hasil seleksi administrasi selama 3 (tiga) hari dari tanggal 4 Agustus 2021 s.d 6 Agustus 2021 melalui laman https://sscasn.bkn.go.id/;

    2.  Tim Verifikator Pengadaan CPASN telah memverifikasi ulang dan menjawab sanggahan pelamar dari tanggal 6 Agustus 2021 s.d 13 Agustus 2021 ;

    3.  Hasil Verifikasi ulang didapatkan bahwa sebanyak 6 (Enam) pelamar Tidak Memenuhi Syarat (TMS) berubah menjadi Memenuhi Syarat (MS) (lampiran I);

    4.  Pelamar yang dinyatakan Memenuhi Syarat (MS) sebagaimana dimaksud pada poin 3 (tiga) dinyatakan Lulus Seleksi Administrasi dan berhak mengikuti seleksi tahapan selanjutnya yaitu Seleksi Kompetensi Dasar (SKD) dengan menggunakan sistem Computer Assisted Test (CAT);

    5.  Pelamar Seleksi CPASN Pemerintah Kabupaten Mamasa  Tahun 2021 yang melakukan sanggahan yang Nama dan Nomor Registernya tidak tercantum dalam Lampiran Pengumuman I (satu) ditolak sanggahannya dan tetap dinyatakan Tidak Memenuhi Syarat (TMS) Seleksi Administrasi, Jawaban atas Tidak Memenuhi Syarat (TMS) dapat dilihat melalui akun masing-masing pelamar melalui link https://sscasn.bkn.go.id/;

    6.  Lampiran II adalah daftar nama pelamar lulus seleksi administrasi CPASN Formasi Umum tahun 2021 di Lingkungan Pemerintah Kabupaten Mamasa dan berhak mengikuti seleksi tahapan selanjutnya yaitu Seleksi Kompetensi Dasar (SKD) dengan menggunakan sistem Computer Assisted Test (CAT);

    7.  Lampiran III adalah daftar pelamar yang tidak lulus seleksi administrasi (TMS) sehingga tidak berhak mngikuti test Seleksi Kompetensi Dasar (SKD);

    8.  Kartu Peserta Ujian dicetak oleh pelamar dengan menggunakan akun masing-masing pelamar melalui link https://sscasn.bkn.go.id/;

    9.  Kartu Peserta Ujian ditandatangani oleh Panitia Pelaksana pada saat pelamar mengikuti Seleksi Kompetensi Dasar CPASN Formasi Umum di masing masing titik lokasi ujian;

    10. Tempat dan waktu pelaksanaan Seleksi Kompetensi Dasar (SKD) CPNS Formasi Umum akan diumumkan lebih lanjut setelah mendapat jadwal dari Kantor Regional IV Badan Kepegawaian Negara;

    11. Kelalaian peserta dalam membaca dan memahami pengumuman ini menjadi tanggung jawab peserta;

    12. Pengumuman ini bersifat FINAL dan tidak dapat diganggu gugat.

     

    Demikian pengumuman ini disampaikan untuk diketahui

    (Download Pengumuman Disini)

    Download Lampiran : Pengumumanhasilverifikasisanggahan.pdf

  • PENGUMUMAN TENTANG PELAKSANAAN SELEKSI KOMPETENSI DASAR (SKD) PENGADAAN CALON PEGAWAI APARATUR SIPIL NEGARA (CPASN) DILINGKUNGAN PEMERINTAH KABUPATEN MAMASA TAHUN 2021

    Sehubungan dengan Surat Kepala Badan Kepegawaian Negara Nomor : 7787/B-KS.04.01/SD/E/2021 tentang Penyampaian Jadwal SKD CPNS Seleksi Kompetensi PPPK Non Guru dan Rekomendasi Ketua Satgas Covid-19 dan mengacu pada Peraturan Badan Kepegawaian Negara Nomor : 2 Tahun 2021 tentang Prosedur Penyelenggaraan Seleksi dengan metode Computer Asissted Test (CAT) Badan Kepegawaian Negara dengan Protokol Kesehatan Pencegahan dan Pengendalian Corona Virus Desease (COVID-19), Dengan ini disampaikan hal sebagai berikut :

    1.  Peserta Seleksi Pengadaan CPNS Kabupaten Mamasa Tahun 2021 yang dinyatakan lulus seleksi administrasi dan lulus pada proses sanggah wajib mengikuti Seleksi Kompetensi Dasar (SKD);

    2.  Seleksi Kompetensi Dasar (SKD) menggunakan system Computer Assisted Test (CAT) BKN dengan tetap memperhatikan protocol kesehatan yang dilaksanakan pada hari/tanggal Senin, 27 September 2021 sd Jumat, 01 Oktober 2021 mulai pukul 06.30 WITA s.d selesai bertempat di Aula SMK Negeri 1 Mamasa Jalan Pendidikan No. 244 Lembang Banggo Mamasa sebagaimana jadwal terlampir;

    3.  Setiap Peserta Wajib melaksanakan dan mematuhi protokol kesehatan dengan berbagai ketentuan sebagai berikut :

    a.    Peserta diwajibkan :

    1)   Melakukan swab test RT PCR kurun waktu maksimal 2x24 jam atau rapid test antigen kurun waktu maksimal 1x24 jam dengan hasil negatif/non reaktif yang pelaksanaannya wajib sebelum mengikuti seleksi CASN Tahun 2021;

    2)   Sebelum berangkat peserta seleksi diharuskan dalam kondisi bersih (mandi dan mencuci rambut) serta menjaga kebersihan;

    3)   Peserta seleksi yang berasal dari wilayah yang berbeda dengan lokasi ujian mengikuti ketentuan protokol perjalanan yang ditetapkan oleh pemerintah;

    4)   Menggunakan masker yang menutupi hidung dan mulut hingga dagu. Menggunakan masker 3 lapis (3 ply) dan ditambah masker kain dibagian luar (double masker);

    5)   Menjaga jarak (physical distancing) minimal 1 (satu) meter;

    6)   Mencuci tangan menggunakan sabun dengan air mengalir atau menggunakan hand sanitizer; 

    7)   Membawa formulir Deklarasi Sehat yang telah diisi dan diunduh pada website sscasn.bkn.go.id dalam kurun waktu 14 (empat belas) hari sebelum mengikuti ujian seleksi dan paling lambat H-1 sebelum ujian, formulir wajib ditunjukkan kepada petugas sebelum dilakukan pemberian PIN registrasi;

    8)   Peserta seleksi wajib diukur suhu tubuhnya;

    9)   Peserta seleksi suhu tubuhnya >37◦C dilakukan pemeriksaan ulang paling banyak 2 (dua) kali dengan jarak waktu pemeriksaan 5 (lima) menit, jika direkomendasikan oleh tim kesehatan dapat mengikuti tes, maka dapat ditempatkan pada tempat yang ditentukan;

    10)    Peserta Seleksi yang suhu tubuhnya <37,3○C langsung menuju ke bagian registrasi;

    11)    Bagi Peserta seleksi yang hasil pemeriksaan ulang kedua tetap memiliki suhu tubuh >37,3◦C berlaku ketentuan sbb :

    a)    Peserta seleksi diperiksa oleh tim kesehatan, apabila tim kesehatan merekomendasikan peserta tetap dapat mengikuti seleksi maka Peserta seleksi dengan ditangani petugas khusus dan ruang seleksi yang sudah disediakan dan terpisah dari peserta lainnya;

    b)   Apabila tim kesehatan merekomendasikan peserta seleksi tidak dapat mengikuti seleksi, maka peserta seleksi diberikan kesempatan mengikuti seleksi pada sesi penjadwalan ulang sesuai rekomendasi tim kesehatan dengan jadwal yang akan ditetapkan BKN;

    c)    Tim Kesehatan membuat surat rekomendasi yang menyatakan dapat/tidak dapat mengikuti seleksi;

    d)   Terhadap rekomendasi tim kesehatan sebagaimana dimaksud pada poin c) Panitia Seleksi berkoordinasi dengan BKN;

    e)    Apabila peserta seleksi sebagaimana dimaksud pada poin b) tidak mengikuti seleksi pada sesi penjadwalan ulang, maka peserta seleksi tersebut dianggap gugur.

    f)     Peserta yang terkena Covid (positif) melaporkan ke instansi untuk dijadwal ulang (pelaporan maksimal pada hari H; jika pelaporan pada H+1 dst dianggap gugur);

    b.   Pelaksanaan SKD CPASN Pemerintah Kabupaten Mamasa menggunakan Sistem Computer Assisted Test Badan Kepegawaian Negara (CAT-BKN);

    c.     Pelaksanaan tes SKD dilaksanakan berdasarkan jadwal tahapan kegiatan dan pembagian sesi sebagaimana terlampir dalam Lampiran 1 & 2.a pada pengumuman ini;

    d.   Pelaksanaan Ujian Peserta yang memilih Titik Lokasi Test di Luar Negeri akan ditentukan kemudian oleh Badan Kepegawaian Negara (BKN) setelah berkoordinasi dengan KBRI setempat Lampiran 2.b;

    e.     Setiap Peserta SKD wajib mematuhi tata tertib pelaksanaan ujian sbb :

    1)   Peserta hadir paling lambat 60 (enam puluh) menit sebelum jadwal yang telah ditentukan untuk proses registrasi dan pemeriksaan kelengkapan dokumen persyaratan peserta seleksi, peserta yang terlambat dalam sesi ujian (login aplikasi CAT) tidak dapat mengikuti ujian dan dinyatakan gugur;

    2)   Peserta wajib membawa dan menunjukkan asli kartu peserta SKD yang telah diunduh melalui akun masing-masing peserta;

    3)   Peserta wajib membawa Kartu Tanda Penduduk Elektronik (KTP-el) asli atau Surat Keterangan Pengganti KTP-el asli yang dikeluarkan oleh Dinas Kependudukan dan Pencatatan Sipil atau Kartu Keluarga asli (atau salinan yang dilegalisir basah oleh pejabat yang berwenang, atau yang ditandatangani secara elektronik); 

    4)   Peserta wajib menggunakan pakaian :

    - Pria           : Kemeja putih lengan panjang, celana kain warna hitam dan sepatu;

    -   Wanita     : Kemeja putih, celana panjang kain/rok warna hitam

    khusus yang berjilbab menggunakan jilbab warna hitam dan sepatu. Bagi peserta yang sedang hamil dapat menggunakan terusan berwarna hitam dan tetap menggunakan kemeja putih.

    5)   Mendengarkan pengarahan panitia sebelum pelaksanaan tes dimulai;

    6)   Mengerjakan semua soal tes yang tersedia sesuai dengan alokasi waktu;

    7)     Pengantar peserta seleksi berhenti di drop zone yang sudah ditentukan,dilarang masuk dan menunggu dan/ atau berkumpul disekitar lokasi seleksi untuk menghindari kerumunan;

    8)     Peserta seleksi melakukan penitipan barang secara mandiri di tempat yang ditentukan dengan tetap menjaga jarak minimal 1 (satu ) meter:

    9)     Peserta seleksi selama mengikuti seleksi wajib melaporkan apabila ada keluhan kesehatan:

    10) Peserta Seleksi dapat keluar dari ruangan seleksi, apabila sudah menyelesaikan soal seleksi dan sudah mencatat hasil skornya dengan tetap menjaga jarak minimal 1 (satu) meter serta meminta izin kepada Tim Pelaksana CAT BKN;

    11) Peserta seleksi setelah mengambil barang yang dititipkan di tempat penitipan secara tertib, segera meninggalkan lokasi seleksi;

    12) Hasil seleksi CAT secara live scoring dapat dilihat melalui media online streaming (youtube) dan link dibagikan sebelum penyelenggaraan seleksi;

    13) Hasil tiap sesi yang dicetak tidak ditempel di papan pengumuman.

           f.      Peserta dilarang :

    1) Membawa jam tangan, perhiasan, kalkulator,telepon genggam (handphone) atau alat komunikasi lainnya dan kamera dalam bentuk apapun di dalam ruangan tes;

    2)     Membawa makanan dan minuman ke dalam ruangan test:

    3)   Membawa senjata api/tajam atau sejenisnya;

    4) Bertanya/berbicara dan menerima/memberikan sesuatu dari/kepada peserta lain tanpa seizin panitia selama tes berlangsung;

    5)     Merokok dalam ruangan;

    6)     Keluar ruangan tes, kecuali memperoleh izin dari panitia.

    g.    Sanksi bagi peserta :

    1)     Peserta yang terlambat pada saat dimulainya tes tidak diperkenankan masuk untuk mengikuti tes dan dianggap gugur;

    2)     Peserta yang tidak hadir mengikuti Seleksi Kompetensi Dasar (SKD) sesuai jadwal dan ketentuan yang telah ditetapkan, maka dinyatakan mengundurkan diri dan gugur;

    3)     Peserta yang melanggar ketentuan/tata tertib dianggap gugur dan dinyatakan tidak lulus;


    h.   Peserta seleksi yang terkonfirmasi positif COVID 19 dapat mengikuti seleksi dengan ketentuan sebagai berikut :

    1)   Bagi peserta seleksi yang telaj terkonfirmasi positif COVID-19 dan sedang menjalani isolasi diwajibkan melapor kepada instansi yang dilamar, kemudian Instansi bersurat ke BKN disertai bukti surat rekomendasi dokter dan/atau hasil sawab PCR dan keterangan menjalani isolasi dari pejabat yang berwenang;

    2)   Bagi peserta yang terkonfirmasi positif COVID-19 dan tidak sedang menjalani isolasi atau sudah menjalani isolasi, maka panitia seleksi instansi melaporkan kepada tim pelaksana CAT BKN dan dibuatkan Berita Acara Peserta terkonfirmasi Positif Covid-19 dan dapat mengikuti seleksi sesuai dengan jadwal yang ditetapkan;

    3)   Surat Panitia Seleksi Instansi sebagaimana dimaksud pada poin a memuat permohonan agar peserta seleksi CPNS yang telah terkonfirmasi positif COVID-19 untuk dapat dijadwalkan diakhir seleksi di lokasi tempat peserta tersebut mengikuti seleksi atau lokasi BKN terdekat;

    4)   Surat Panitia Seleksi Instansi sebagaimana dimaksud pada poin a, BKN akan mengatur kembali jadwal peserta seleksi CPNS yang telah terkonfirmasi positif COVID-19 dan sedang menjalani isolasi.

    4)   Pelaksanaan Seleksi Kompetensi bagi Pegawai Pemerintah dengan Perjanjian Kerja (PPPK) Formasi Guru dilingkungan Pemerintah Kabupaten Mamasa Tahun 2021 akan disampaikan oleh pihak Kementerian Pendidikan, Kebudayaan, Riset dan Teknologi RI yang terpisah dari pengumuman ini;

    5)   Informasi terkait pelaksanaan SKD akan disampaikan melalui :

    -                              Website BKPP Kab. Mamasa https://bkpp.mamasakab.go.id/

    -                              Group Facebook “LAYANAN BKPP Mamasa”

    -                              Group Telegram “ HELP DESK CPASN KAB. MAMASA”

     

    Demikian Pengumuman ini disampaiakan untuk menjadi perhatian.

    (DOWNLOAD PENGUMUMAN DISINI)

    Download Lampiran : pengumuman.pdf

...
DIRGAHAYU REPUBLIK INDONESIA

Masih ada setitik harapan, mimpi yang kita jaga. Masih ada cita-cita yang bias kita bagikan. Kemerdekaan bukan sekedar ritual belaka, tetapi ajang membangun bangsa. Kemerdekaan bukanlah tanda untuk ....

...
INFO LAYANAN TASPEN

Apabila ada Pertanyaan lebih lanjut bisa Menghubungi kami melalui : WhatsApp 1 : 081-4211-223 WhatsApp 1 : 0821-89-7879-89 Tetap hati-hati terhadap Segala Bentuk Penipuan, Pemerasan dan Biaya yang ....

...
PENGUMUMAN DIREKTUR JENDERAL GURU DAN TENAGA KEPENDIDIKAN SELAKU KETUA PANITIA SELEKSI PPPK JF GURU

TENTANG SELEKSI PENERIMAAN PEGAWAI PEMERINTAH DENGAN PERJANJIAN KERJA UNTUK JABATAN FUNGSIONAL GURU PADA PEMERINTAH DAERAH TAHUN 2021 UNTUK AKSES/Download, KE MENU PENGUMUMAN CPASN DAN PPPK ....

Selamat Datang
Sambutan Kepala Badan

Puji syukur ke hadirat Tuhan Yang Maha Esa, karena atas berkat, rahmat dan ridho-Nya jualah akhirnya website resmi BKDD MAMASA dapat dilaunching dengan tampilan dan fitur pemerintahan dengan domain www.bkdd.mamasakab.go.id., Kita ketahui bersama bahwa di jaman ini, internet telah memberikan perubahan secara revolusioner terhadap cara hidup dan aktivitas manusia sehari-hari. Melalui internet, .... ...

Video
Pelatihan Kepemimpinan Administrator dan Pengawas Angk I 2021
Pengumuman/Info Penting
05-03-2019 - Bintek Aplikasi di Makassar

Pegawai Kantor Badan Kepegawaian Pendidikan dan Pelatihan

05-03-2019 - Rapat Kegiatan Hari ULTAH Mamasa

Di harapkan ANS datang ke Kantor Bupati Ruang Aula

Pengambilan Sumpah Jabatan

Klik Untuk Lihat Foto-foto

Kegiatan Pegawai BKPP

Klik Untuk Lihat Foto-foto

Kontak Kantor :
Alamat : Kompleks Perumahan Pemda Dengen, Kabupaten Mamasa Sulbar
Email : info@bkpp.mamasakab.go.id
Telepon : 0428-2841016 / 2841017
Dapatkan Kami di :
  Facebook
  Youtube